Отмена вложения списков в столбце Python Polars генерирует ошибку SchemaError

Я новичок в Polars. Я пытаюсь использовать метод .unnest() для столбца во фрейме данных Polars. В приведенном ниже примере я генерирую столбец «обработанный» как списки строк. Строки состоят из последовательности и процентов, преобразованных в строку. Моя цель — отключить все списки в ячейках столбца и создать два других столбца: один для последовательности, а другой для соответствующего процента. Хотя я уже использовал метод unnest в идентичном случае (это сработало), сейчас он не работает. Я думаю, что есть некоторая проблема, связанная с созданием столбца «обработано». Однако я не могу понять, в чем проблема.

Мой код:

import polars as pl
from functools import reduce

# Function to MAP the peptide inside the protein sequence.
# Convert the peptide sequence in dashes inside the original protein sequence.
def replace_peptide(protein_sequence, peptide):
    return protein_sequence.replace(peptide, '-' * len(peptide))

# Function to COLLAPSE all the dashed protein sequences to generate a final sequence 
# that reports a "-" for each letter in the peptide sequence that map in the protein sequence.
def combine_sequences(seq1, seq2):
    return ''.join(['-' if a == '-' or b == '-' else a for a, b in zip(seq1, seq2)])

# Function to apply the mapping procedure for each row in the dataframe.
def process_row(row):
    protein_sequence = row['sequence']
    protein_sequence_len = len(protein_sequence)
    peptides = row['peptide']
    modified_sequences = [replace_peptide(protein_sequence, peptide) for peptide in peptides]
    final_sequence = reduce(combine_sequences, modified_sequences)
    coverage = str('{:.2f}%').format(final_sequence.count('-')/protein_sequence_len*100)
    return final_sequence, coverage
# -----------------------------------------------------------------------------------------------# 
# Generate the data frame
coverage_fasta=pl.DataFrame({"protein_id": ["A0A024RBG1", "A0A087X1C5", "A0A0B4J2F0"],
                             "sequence": ["MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPG",
                                          "MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVD",
                                            "MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESE"],
                             "peptide": [["MMKFKPNQT", "FKKRAA", "SSSRYPDQ"],
                                         ["EALVPLAM", "AQLLFATVLGIAG", "QPVFEQYAKDQ"], 
                                         ["RRLTFAQLL", "LTFAQLLFATVLGIAGG", "QYAKDQKEL"]
                            ]}
)

# Generate the column that contain a list made by the protein sequences dashed and their coverage percentage.
coverage_fasta = coverage_fasta.with_columns(
    pl.struct(["sequence", "peptide"]).map_elements(lambda row: process_row(row),
                                                    return_dtype=pl.List(pl.String())
                                                    ).alias("processed"))
display(coverage_fasta)

# Command to unnest the lists in the "processed" column. 
# The purpose is to have the dashed sequences in one column and the percentage of coverage in another one.
coverage_fasta = coverage_fasta.with_columns(pl.col("processed")).unnest("processed")
display(coverage_fasta)

Выход:

Пожалуйста, может кто-нибудь объяснить, что я делаю неправильно?